PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_16064
Common NameKK1_016532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 909aa    MW: 100185 Da    PI: 5.9689
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_16064genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28550601152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+isl+ l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  C.cajan_16064 550 AEKSISLDILQHYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 601
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.177538621IPR003035RWP-RK domain
PfamPF020428.0E-25554601IPR003035RWP-RK domain
SuperFamilySSF542775.89E-22808894No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-25809890No hitNo description
PROSITE profilePS5174522.5809891IPR000270PB1 domain
SMARTSM006662.4E-25809891IPR000270PB1 domain
PfamPF005643.5E-18810890IPR000270PB1 domain
CDDcd064078.68E-31810890No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MDFDIGLESP WPLDHVSLVS NPMSPFLLST ISEQPFSPVW AFSDVEDDRQ IRIAASGNTN  60
TTNENPVEND ANKKTVSPLV ALPPSENPDG YCLIKERMTQ ALRHFKELTE QNVLAQVWAP  120
VRNGNRYALT TSGQPFVLDP HSNGLHQYRT VSLMYMFSVD GENDEIQGLP GRVFQHKIPE  180
WTPNVQYYSS KEYQRLNHAQ HYNVRGTLAL PVFEPAGQSC VAVLELIMTS QKINYAPEVD  240
KICKALEAVN LRSSEILEHP YNQICNEDRQ YALAEILEIL TVVCETHSLP LAQTWVPCKH  300
RSVLAHGGGV KKSCSSFDGC CMGQVCMSIT EVAFYVIDAR TWGFHEACVE HHLQQGQGVA  360
GRAFLSHKMC FCGNITQFCK TEYPLVHYAI MFGLTSCFAV CLQSSHTGND EYVLEFFLPP  420
MITDFNEQKS LLGSILATMK PHFQSFKIAA GVELEENGSV EIVEAINERV HLRFESIPIT  480
QSSKSPPRHA LPNMGEALPP EPSEQQIMAY CDDINDGGSL GDNAGGHIDQ NTLLETKTKK  540
KPSERKRGKA EKSISLDILQ HYFTGSLKDA AKSLGVCPTT MKRICRQHGI SRWPSRKIKK  600
VNRSLSKLKC VIESVHGAEG AFGLNSLSTS SLPIAAGSFS EPSTSNKQIE MGEQFLGART  660
QSPEKLINDK VGTIQEIGTK GSNKLRTGSG SSEGSANPTP HGSCQGSPPN EISPTKDIFI  720
AGNNEQCLVL RGSLESTLLS TRTSTPNRPT AYPMPNIVDT TEPQVPFVGQ LLEGAGSSKD  780
LRNLCPSADA VLEDQVPEAC RMNPQRVKSV TIKATYKEDI IRFKVSLDCG IVELKEEIAK  840
RLKLEVVTFD IKYLDDDHEW VLIACDADLL ECMDISSSSG SNIIRLVVHD ILSILGSSCE  900
SSGDWKGCI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533182.20.0PREDICTED: protein NLP6-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A151T4P90.0A0A151T4P9_CAJCA; Uncharacterized protein
STRINGGLYMA09G25230.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7